DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and CG34461

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001097547.1 Gene:CG34461 / 5740547 FlyBaseID:FBgn0250833 Length:138 Species:Drosophila melanogaster


Alignment Length:148 Identity:66/148 - (44%)
Similarity:84/148 - (56%) Gaps:21/148 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FVALLALIAAASAGVLPAGQLYHAAPVATYAAPAPAAVLKTV-AQPVLAKADEEYDPHPQYKYAY 68
            |||:..|.|||.|..:..|   |.||...:.||..:..:..| |:||         .:|:|.:.|
  Fly     4 FVAIALLFAAAQAVPIELG---HYAPALVHHAPVLSHAVHAVHAEPV---------AYPKYSFNY 56

  Fly    69 DVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNREPLVKTVVKTV 133
            .::|..:||.|||.||||||||:|:||||:.||..|||.||||..|||||||::....|.:..  
  Fly    57 GIKDPHTGDIKSQAEERDGDVVKGQYSLVEPDGSVRTVDYTADDHNGFNAVVHKTAPSKIIAH-- 119

  Fly   134 APV---APVYA---AYHH 145
            |||   |||.|   ..||
  Fly   120 APVLHAAPVLAHAPLLHH 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 31/51 (61%)
CG34461NP_001097547.1 Chitin_bind_4 52..104 CDD:459790 31/51 (61%)

Return to query results.
Submit another query.