DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and LOC4578144

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:XP_001238069.4 Gene:LOC4578144 / 4578144 VectorBaseID:AGAMI1_006540 Length:151 Species:Anopheles gambiae


Alignment Length:87 Identity:24/87 - (27%)
Similarity:38/87 - (43%) Gaps:12/87 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 QYKYAYDVQDAISGDSKSQ---VEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNREP 124
            :::|:|:..|........|   |..:.|...:|:|:....||...::.|.||. ||:..|.:..|
Mosquito    58 KFRYSYEGGDGTRAAQDGQQIVVNNQVGTASQGQYTYQGDDGKTYSISYIADE-NGYRPVGDHLP 121

  Fly   125 LVKTVVKTVAPV-APVYAAYHH 145
                   |..|| ||:..|..|
Mosquito   122 -------TPPPVPAPIARALAH 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 14/54 (26%)
LOC4578144XP_001238069.4 None

Return to query results.
Submit another query.