DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Cpr92F

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster


Alignment Length:141 Identity:45/141 - (31%)
Similarity:53/141 - (37%) Gaps:39/141 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FVALLALIAAASAGVLPAGQLYHAAPVATYAAPAPAAVLKTVAQPVLAKADEEYDPHPQ-YKYAY 68
            |:|...||:..||.       :|.|....|                     :..|||.. |.|.|
  Fly     5 FIAAALLISTVSAS-------WHGAVSTQY---------------------QHLDPHSHTYSYGY 41

  Fly    69 DVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNREPLVKTVVKTV 133
                |.....|.:....|| ...|.||.||..|..::|.|||||.:|||||....|....|    
  Fly    42 ----ADPNSQKHETRSHDG-TTHGSYSYVDGHGHVQSVSYTADPHHGFNAVGTNLPQAPQV---- 97

  Fly   134 APVAPVYAAYH 144
             ..||||||.|
  Fly    98 -HAAPVYAAAH 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 19/51 (37%)
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:459790 19/51 (37%)

Return to query results.
Submit another query.