DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Cpr92F

DIOPT Version :9

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster


Alignment Length:141 Identity:45/141 - (31%)
Similarity:53/141 - (37%) Gaps:39/141 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FVALLALIAAASAGVLPAGQLYHAAPVATYAAPAPAAVLKTVAQPVLAKADEEYDPHPQ-YKYAY 68
            |:|...||:..||.       :|.|....|                     :..|||.. |.|.|
  Fly     5 FIAAALLISTVSAS-------WHGAVSTQY---------------------QHLDPHSHTYSYGY 41

  Fly    69 DVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNREPLVKTVVKTV 133
                |.....|.:....|| ...|.||.||..|..::|.|||||.:|||||....|....|    
  Fly    42 ----ADPNSQKHETRSHDG-TTHGSYSYVDGHGHVQSVSYTADPHHGFNAVGTNLPQAPQV---- 97

  Fly   134 APVAPVYAAYH 144
             ..||||||.|
  Fly    98 -HAAPVYAAAH 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:278791 19/51 (37%)
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:278791 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453168
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.