DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Ccp84Ad

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster


Alignment Length:202 Identity:126/202 - (62%)
Similarity:133/202 - (65%) Gaps:60/202 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFVALLALIAAASAGVLPAGQLYHAAP-VATYAAPAPAAVLKTVAQPVLAKADEEYDPHPQY 64
            |||||:||.||||||||||||..|:||||| |||| |.||.||..  ||||||||.|||||||||
  Fly     1 MAFKFIALFALIAAASAGVLPVQQVYHAAPAVATY-AQAPVAVAH--AQPVLAKAAEEYDPHPQY 62

  Fly    65 KYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNREPLVK-- 127
            ||||||||::||||||||||||||||||||||:|:||:|||||||||||||||||||||||||  
  Fly    63 KYAYDVQDSLSGDSKSQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLVKAV 127

  Fly   128 ---------------------------TVVKTVAP------------VAPV-----------YA- 141
                                       .|||||||            ||||           || 
  Fly   128 AVAPVVKTVAAPVAHYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVAHYAAPATYTSYAA 192

  Fly   142 ---AYHH 145
               ||||
  Fly   193 PAVAYHH 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 46/51 (90%)
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 46/51 (90%)

Return to query results.
Submit another query.