Sequence 1: | NP_572266.1 | Gene: | Cpr5C / 31510 | FlyBaseID: | FBgn0029811 | Length: | 145 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_649680.1 | Gene: | Ccp84Ad / 40822 | FlyBaseID: | FBgn0004780 | Length: | 199 | Species: | Drosophila melanogaster |
Alignment Length: | 202 | Identity: | 126/202 - (62%) |
---|---|---|---|
Similarity: | 133/202 - (65%) | Gaps: | 60/202 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MAFKFVALLALIAAASAGVLPAGQLYHAAP-VATYAAPAPAAVLKTVAQPVLAKADEEYDPHPQY 64
Fly 65 KYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNREPLVK-- 127
Fly 128 ---------------------------TVVKTVAP------------VAPV-----------YA- 141
Fly 142 ---AYHH 145 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cpr5C | NP_572266.1 | Chitin_bind_4 | 64..116 | CDD:278791 | 46/51 (90%) |
Ccp84Ad | NP_649680.1 | Chitin_bind_4 | 62..114 | CDD:278791 | 46/51 (90%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45440137 | |
Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I19263 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 1 | 1.000 | - | - | H43711 | |
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D133302at33392 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0006710 | |
OrthoInspector | 1 | 1.000 | - | - | otm50847 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR12236 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
8 | 7.950 |