DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Ccp84Ae

DIOPT Version :9

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster


Alignment Length:158 Identity:90/158 - (56%)
Similarity:97/158 - (61%) Gaps:31/158 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFVALLALIAAASAGVLPAGQLYHAAPVATYAAPAPAAVLKTVAQPVLAKAD--EEYDPHPQ 63
            ||.|.|..|||.|.|...||..     |||||..:||.          |||||..  ||.|||||
  Fly     1 MAAKIVIALALFAVAHGAVLRT-----AAPVAVASAPV----------PVLAKTVELEEVDPHPQ 50

  Fly    64 YKYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNREPLVKT 128
            |.|:|||||.:|||:|..|||||||||||||||:|:|||||||.||||.||||||||.||||...
  Fly    51 YTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVRREPLAAV 115

  Fly   129 V------------VKT--VAPVAPVYAA 142
            |            ||.  |||:|||..|
  Fly   116 VAAEPLLKVAAPLVKAAPVAPIAPVALA 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:278791 40/51 (78%)
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:278791 40/51 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440162
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H43711
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133302at33392
OrthoFinder 1 1.000 - - FOG0006710
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.