DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Ccp84Af

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster


Alignment Length:151 Identity:116/151 - (76%)
Similarity:127/151 - (84%) Gaps:10/151 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFVALLALIAAASAGVLPAGQLYHAAP-VATYAAPAPAAVLKTVAQPVLAKADEEYDPHPQY 64
            |||||.|:||||:||||||||..|:||||| |||| |.||.||..  |||||.||.|||||||||
  Fly     1 MAFKFFAVLALISAASAGVLPVQQVYHAAPAVATY-AQAPVAVAH--AQPVLTKATEEYDPHPQY 62

  Fly    65 KYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNREPL--VK 127
            |:||||||::||||||||||||||||.|||||:||||:||.||||:||:|||||||||.||  ||
  Fly    63 KFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPLDHVK 127

  Fly   128 TVVKTVAPV----APVYAAYH 144
            |||||||||    ||:..|||
  Fly   128 TVVKTVAPVAVAAAPIPVAYH 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 42/51 (82%)
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 42/51 (82%)

Return to query results.
Submit another query.