DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Cpr72Eb

DIOPT Version :9

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_648883.1 Gene:Cpr72Eb / 39815 FlyBaseID:FBgn0036618 Length:217 Species:Drosophila melanogaster


Alignment Length:93 Identity:29/93 - (31%)
Similarity:41/93 - (44%) Gaps:15/93 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 APVATYAAPAPAAVLKTVAQPVLAKADEEYDPHPQYKYAYDVQDAISGDSKSQVEERDGDVVRGE 93
            :|...|..|..:   .|::|      ....|.|.||.|.|    .....||.:....|| |:||.
  Fly    19 SPTLEYGPPPTS---DTISQ------YHHQDEHGQYAYGY----MAPLYSKHETRTVDG-VIRGT 69

  Fly    94 YSLVDSDGFKRTVQYTADPINGFNAVVN 121
            :|.:|::|..:||.|.|| ..||:...|
  Fly    70 FSHIDANGETQTVDYVAD-AEGFHVTSN 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:278791 18/51 (35%)
Cpr72EbNP_648883.1 Chitin_bind_4 45..91 CDD:278791 18/51 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453192
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.