DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Cpr72Eb

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_648883.1 Gene:Cpr72Eb / 39815 FlyBaseID:FBgn0036618 Length:217 Species:Drosophila melanogaster


Alignment Length:93 Identity:29/93 - (31%)
Similarity:41/93 - (44%) Gaps:15/93 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 APVATYAAPAPAAVLKTVAQPVLAKADEEYDPHPQYKYAYDVQDAISGDSKSQVEERDGDVVRGE 93
            :|...|..|..:   .|::|      ....|.|.||.|.|    .....||.:....|| |:||.
  Fly    19 SPTLEYGPPPTS---DTISQ------YHHQDEHGQYAYGY----MAPLYSKHETRTVDG-VIRGT 69

  Fly    94 YSLVDSDGFKRTVQYTADPINGFNAVVN 121
            :|.:|::|..:||.|.|| ..||:...|
  Fly    70 FSHIDANGETQTVDYVAD-AEGFHVTSN 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 18/51 (35%)
Cpr72EbNP_648883.1 Chitin_bind_4 45..91 CDD:459790 18/51 (35%)

Return to query results.
Submit another query.