DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Cpr67B

DIOPT Version :9

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_648306.1 Gene:Cpr67B / 39081 FlyBaseID:FBgn0035985 Length:260 Species:Drosophila melanogaster


Alignment Length:136 Identity:34/136 - (25%)
Similarity:43/136 - (31%) Gaps:50/136 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 DEEYDPHPQY-------KYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADP 112
            :|.||.| ||       ::||..:|...|  |::..:..|.|. |.|..|...|......|.||.
  Fly    81 EEHYDAH-QYHGQDGLGQFAYGYRDWNQG--KNEKRDETGKVT-GSYKYVQPHGRDFVANYYADK 141

  Fly   113 INGFNAVVNRE-----PLVKT--VVKT-------------------------------VAPVAPV 139
             .||:...||.     |..||  |:|.                               ..|..|.
  Fly   142 -TGFHVEDNRPAHLKLPATKTPAVLKAEEEHFKLWGELAAAAGHNPDPYAAEYQQEGRYQPTEPE 205

  Fly   140 YAAYHH 145
            |..|.|
  Fly   206 YQPYVH 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:278791 15/58 (26%)
Cpr67BNP_648306.1 Chitin_bind_4 <111..144 CDD:278791 9/34 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453167
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.