DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Cpr65Eb

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster


Alignment Length:120 Identity:21/120 - (17%)
Similarity:44/120 - (36%) Gaps:39/120 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VLKTVAQPVL----AKADEEYDPHPQ--------------YKYAYDVQDAIS----------GDS 78
            |:..||..||    |:..:..|.|.:              |.|.::..:.|:          ...
  Fly     6 VVVLVAMSVLLGVQARPSDSPDAHAEIRSFVNELKQEDGIYNYQFETSNGIAQQEQGVGGYYASG 70

  Fly    79 KSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNREPLVKTVVKTV 133
            .||....:|.:::..|: .|.:||:...::...|          .|:.:.::|::
  Fly    71 SSQYYTPEGQLIQLTYT-ADENGFQPQGEHLPTP----------HPIPEAILKSL 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 11/61 (18%)
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:459790 8/47 (17%)

Return to query results.
Submit another query.