DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Cpr62Bc

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_647668.1 Gene:Cpr62Bc / 38241 FlyBaseID:FBgn0035281 Length:180 Species:Drosophila melanogaster


Alignment Length:159 Identity:75/159 - (47%)
Similarity:90/159 - (56%) Gaps:33/159 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FKFVALLALIAAASAGVL---PAGQLYHAAPVATYAAPAPAAVLKTVAQPVLAKADE--EYDPHP 62
            ||.:..||:::|||||||   .|| ||.||| |.||..              ...||  :|..:|
  Fly     4 FKSLICLAVLSAASAGVLHGHGAG-LYAAAP-AIYAGH--------------GHHDEGIDYHAYP 52

  Fly    63 QYKYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNRE-PLV 126
            :|.|.|.|.|:.:||.|||.|.||||||:|.||||:.||..|||:||||..|||||||::. |.|
  Fly    53 KYHYNYGVADSHTGDVKSQHEVRDGDVVKGSYSLVEPDGSVRTVEYTADDHNGFNAVVHKTGPTV 117

  Fly   127 ----KTVVKTVAP----VAPVYA---AYH 144
                ..||...||    .||.||   |:|
  Fly   118 HHAAPAVVAHAAPAVVHAAPAYAPAIAHH 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 32/51 (63%)
Cpr62BcNP_647668.1 Chitin_bind_4 54..106 CDD:459790 32/51 (63%)

Return to query results.
Submit another query.