DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Cpr62Bc

DIOPT Version :9

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001261293.1 Gene:Cpr62Bc / 38241 FlyBaseID:FBgn0035281 Length:180 Species:Drosophila melanogaster


Alignment Length:159 Identity:75/159 - (47%)
Similarity:90/159 - (56%) Gaps:33/159 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FKFVALLALIAAASAGVL---PAGQLYHAAPVATYAAPAPAAVLKTVAQPVLAKADE--EYDPHP 62
            ||.:..||:::|||||||   .|| ||.||| |.||..              ...||  :|..:|
  Fly     4 FKSLICLAVLSAASAGVLHGHGAG-LYAAAP-AIYAGH--------------GHHDEGIDYHAYP 52

  Fly    63 QYKYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNRE-PLV 126
            :|.|.|.|.|:.:||.|||.|.||||||:|.||||:.||..|||:||||..|||||||::. |.|
  Fly    53 KYHYNYGVADSHTGDVKSQHEVRDGDVVKGSYSLVEPDGSVRTVEYTADDHNGFNAVVHKTGPTV 117

  Fly   127 ----KTVVKTVAP----VAPVYA---AYH 144
                ..||...||    .||.||   |:|
  Fly   118 HHAAPAVVAHAAPAVVHAAPAYAPAIAHH 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:278791 32/51 (63%)
Cpr62BcNP_001261293.1 Chitin_bind_4 54..106 CDD:395303 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.