DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Cpr62Bb

DIOPT Version :9

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001137869.1 Gene:Cpr62Bb / 38240 FlyBaseID:FBgn0035280 Length:194 Species:Drosophila melanogaster


Alignment Length:146 Identity:61/146 - (41%)
Similarity:77/146 - (52%) Gaps:41/146 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VATYAAPAPAAVLKTVAQPVLAKADEEYDPHPQYKYAYDVQDAISGDSKSQVEERDGDVVRGEYS 95
            :|.:|:.|       ||:|..|.   :|..||:|.:.|.|.|..:||.|||.|.||||||:|:||
  Fly    12 LALFASVA-------VARPGYAL---DYYDHPKYAFNYGVADHSTGDVKSQHETRDGDVVKGQYS 66

  Fly    96 LVDSDGFKRTVQYTADPINGFNAVVNR------------EPLV----------KTVVKTVAPV-- 136
            ||:.||..|||.||||.|:||||||.:            .|:|          ..|||.||||  
  Fly    67 LVEPDGSIRTVDYTADSIHGFNAVVTKSGPTVHAQAVVASPIVAHKPVLTHYEPQVVKHVAPVAH 131

  Fly   137 APV-------YAAYHH 145
            ||:       |.|.|:
  Fly   132 APLVVASPAPYVAKHY 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:278791 31/51 (61%)
Cpr62BbNP_001137869.1 Chitin_bind_4 35..87 CDD:395303 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.