DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Cpr49Af

DIOPT Version :10

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_610775.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster


Alignment Length:141 Identity:39/141 - (27%)
Similarity:58/141 - (41%) Gaps:42/141 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KFVALLAL-IAAASAGVLPAGQLYHAAPVATYAAPAPAAVLKTVAQPVLAKADEEYDPHPQYKYA 67
            |::.|:|| :.||||                          .....|:..:::.||  :.:|.|.
  Fly     2 KYLMLIALFVVAASA--------------------------TDNDDPISQESNVEY--NGKYHYH 38

  Fly    68 YDVQDAI----SGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNREPLVKT 128
            |:::|..    .|..||...:.:|:.|.|:||.|..||....|.||||. ||:.||.:..|    
  Fly    39 YELKDGSKATQDGVLKSVNADHNGESVNGKYSFVADDGKTYVVSYTADE-NGYLAVGDHLP---- 98

  Fly   129 VVKTVAPVAPV 139
                ..|..||
  Fly    99 ----TPPPTPV 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 21/55 (38%)
Cpr49AfNP_610775.1 Chitin_bind_4 35..90 CDD:459790 21/55 (38%)

Return to query results.
Submit another query.