DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Crys

DIOPT Version :9

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001285854.1 Gene:Crys / 34604 FlyBaseID:FBgn0005664 Length:477 Species:Drosophila melanogaster


Alignment Length:79 Identity:40/79 - (50%)
Similarity:63/79 - (79%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 AQPVLAKADEEYDPHPQYKYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTAD 111
            |..:...::|:||..|||.:||||:|:::||.|.|.|:||||:|:|:|||::.||.:|.|:||||
  Fly    60 ATTLAPNSNEDYDTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTAD 124

  Fly   112 PINGFNAVVNREPL 125
            .::||||:|:::.|
  Fly   125 DVSGFNAIVSKQRL 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:278791 28/51 (55%)
CrysNP_001285854.1 Chitin_bind_4 77..129 CDD:278791 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453148
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.