DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and CG42367

DIOPT Version :9

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster


Alignment Length:118 Identity:46/118 - (38%)
Similarity:60/118 - (50%) Gaps:30/118 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLALIAAASAGVLPAGQLYHAAPVATYAAPAPAAVLKTVAQPVLAKADEEYDPHPQYKYAYDVQD 72
            :|:.:.|..||::.:    |  |....|:||                        ||::.|.|.|
  Fly    13 ILSALVAVQAGIIAS----H--PDELIASPA------------------------QYEFHYSVHD 47

  Fly    73 AISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNREPL 125
            :.|||.|.|.|.|.|:.|.|.|||||.||.:|.|.|||||:.||||.|.|||:
  Fly    48 SHSGDVKDQFEHRRGEYVTGRYSLVDPDGHRRIVDYTADPLLGFNAQVRREPI 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:278791 28/51 (55%)
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:278791 25/46 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453236
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.