DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr5C and Cpr31A

DIOPT Version :9

Sequence 1:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster


Alignment Length:237 Identity:81/237 - (34%)
Similarity:100/237 - (42%) Gaps:94/237 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAFKFVALLALIAAAS----------AGVLPA-------GQLYHAAPVA---------------- 32
            ||.|.:.:.:|:|.|:          ||..||       ..:|||||||                
  Fly     1 MAGKLLTVFSLLAIAASCRAGFAATYAGYHPAYATYQAPAAVYHAAPVAQAAVYQQAAPVYAKTF 65

  Fly    33 ---------TYAAPAP-----------------------------AAVLKTVAQPVLAKADEEYD 59
                     :||.|.|                             |.|:||||.........|.:
  Fly    66 VPAAPVYTRSYALPTPVVKAVAPAPLALPVAAPVVKTLAAAPVVAAPVVKTVAAAPAVLKQVELE 130

  Fly    60 PHPQYKYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNREP 124
            ..|:|.::|.|.|:|:||.|||||.|||..|.|.||::|:|||||||.||||.||||||||.|||
  Fly   131 SSPRYDFSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGFNAVVQREP 195

  Fly   125 LVKT------VVKTVAPV---------------APVYAAYHH 145
            :|..      ||...||.               ||:|  |.|
  Fly   196 VVAARAVAAPVVSVSAPAPVPVHISSAPVASLPAPIY--YPH 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:278791 33/51 (65%)
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453235
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.