Sequence 1: | NP_572266.1 | Gene: | Cpr5C / 31510 | FlyBaseID: | FBgn0029811 | Length: | 145 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_995678.1 | Gene: | Cpr31A / 2768918 | FlyBaseID: | FBgn0053302 | Length: | 340 | Species: | Drosophila melanogaster |
Alignment Length: | 237 | Identity: | 81/237 - (34%) |
---|---|---|---|
Similarity: | 100/237 - (42%) | Gaps: | 94/237 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MAFKFVALLALIAAAS----------AGVLPA-------GQLYHAAPVA---------------- 32
Fly 33 ---------TYAAPAP-----------------------------AAVLKTVAQPVLAKADEEYD 59
Fly 60 PHPQYKYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNREP 124
Fly 125 LVKT------VVKTVAPV---------------APVYAAYHH 145 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cpr5C | NP_572266.1 | Chitin_bind_4 | 64..116 | CDD:278791 | 33/51 (65%) |
Cpr31A | NP_995678.1 | Chitin_bind_4 | 135..187 | CDD:278791 | 33/51 (65%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45453235 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1544103at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR12236 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.950 |