DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12239 and CG15333

DIOPT Version :9

Sequence 1:NP_572265.1 Gene:CG12239 / 31509 FlyBaseID:FBgn0029810 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_572431.2 Gene:CG15333 / 31720 FlyBaseID:FBgn0029989 Length:542 Species:Drosophila melanogaster


Alignment Length:202 Identity:42/202 - (20%)
Similarity:77/202 - (38%) Gaps:49/202 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 GKERREETRVRLDSSLRLEAREARNERRETRE--ERVQPR------------ETREVRVDRRAAR 130
            ||..|||..|.:...::.|..:..::..|::.  ..|:|:            ||:|.:..:.|..
  Fly   327 GKICREEPAVDMIKKIQFEIEKKASDDAESKATLAGVKPKFDISITKGFMVMETKEPKSPKGAYS 391

  Fly   131 EDQLDAREARDE-------RREAREERVQALETREARVDRRE-----SREDREDRRESRADRE-- 181
            ....|  ||.|:       ::.|..|  :|.||||    |.|     .:....|:..:.||::  
  Fly   392 VQNYD--EAFDDGCIVRVVKKPATAE--EATETRE----RNEMCTVGDQSQELDKCSTEADQKYL 448

  Fly   182 --DRRESREDRLEGREARVQRVEQREARDNQ-----------VELREIREIREHRRVTPEERVEQ 233
              ...:|..|.:....||:...:.....|.:           ::||.:.|.|...|...::.::.
  Fly   449 SCFHVDSDIDNIAMAMARLGIADMSLHADEEELCGIDGDNALIQLRHVLEDRNQIRSHTDQLMQD 513

  Fly   234 RGIREDR 240
            ...|.:|
  Fly   514 HIFRMNR 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12239NP_572265.1 PRK12678 62..>268 CDD:237171 42/202 (21%)
CG15333NP_572431.2 DM7 61..154 CDD:128930
DM7 254..354 CDD:128930 7/26 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CARS
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.