DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12239 and CG15332

DIOPT Version :9

Sequence 1:NP_572265.1 Gene:CG12239 / 31509 FlyBaseID:FBgn0029810 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_572429.1 Gene:CG15332 / 31714 FlyBaseID:FBgn0029986 Length:571 Species:Drosophila melanogaster


Alignment Length:218 Identity:42/218 - (19%)
Similarity:72/218 - (33%) Gaps:51/218 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VDSVARDDRGKERREETRVRLDSSLRLEAREARNERRET------------------REERVQPR 117
            |...:||....:..||.|:..|...|..|:...:...||                  .::...|.
  Fly   345 VGKYSRDGECTDMIEEIRMNFDKKARESAKSIASLTLETLGGLSRHITSTKGFLVMESDKPTPPA 409

  Fly   118 ETREVRVDRRAAREDQLDAREARDERREAREERVQALETREARVD----RRESREDREDRRESRA 178
            ....|. ....|.||...|:..::...:..:.|...:.|.:.:..    ..|...:.||..|..|
  Fly   410 GAYSVE-SYEEASEDGCIAKVTKECASKITDTRDDGINTADYQSQFPELEPEPEPEPEDEGEDVA 473

  Fly   179 DRED-----RRESREDRLE--------------GREARVQRVEQREARDNQVELREIREIREHRR 224
            :::.     :.:|..|.:.              |.|..|..|      |.::.|.::||:.|:| 
  Fly   474 NKKKCLSCFKIDSDIDVMSHAIAELTVAELSMLGEENPVPGV------DTELALDQLREVLENR- 531

  Fly   225 VTPEERVEQRGIREDRVERHEAD 247
              .|.|.....:..|.:.|.|.|
  Fly   532 --GEIRSNTDDLMRDHIYRMERD 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12239NP_572265.1 PRK12678 62..>268 CDD:237171 42/218 (19%)
CG15332NP_572429.1 DM7 80..174 CDD:128930
class_II_aaRS-like_core 160..>205 CDD:294192
DM7 273..373 CDD:128930 8/27 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CARS
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.