DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and CPR2

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_011924.1 Gene:CPR2 / 856454 SGDID:S000001099 Length:205 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:42/214 - (19%)
Similarity:75/214 - (35%) Gaps:57/214 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 STLGE-----NEVFNKYIGWDLDMPDEYFELMRLLRPRIVLHFGLMDGRPLGQVVVQLYTEAAPL 232
            |.:||     :||..:.:.:|::..:|                      .:|::|:.||.:..|.
Yeast    21 SDVGELIDQDDEVITQKVFFDIEHGEE----------------------KVGRIVIGLYGKVCPK 63

  Fly   233 VVLQFVRTC---------LGQRSHEFAVRRIFPRLWVEGYLLSSCKNSLGEASSLSYRDPMEFDT 288
            ....|.:..         :|...|     |:.|...|:|   ....:..|......|.|....:.
Yeast    64 TAKNFYKLSTTTNSKKGFIGSTFH-----RVIPNFMVQG---GDFTDGTGVGGKSIYGDTFPDEN 120

  Fly   289 RVVSHARYAFVLSCA---KEYCVHGFPGGAINFSISFKPLPVARGQRVGFGRVIRGDKVIEAMEA 350
            ..:.|.|.. .||.|   |:      ..|:..|..:.:......|:.|.||:|:.|..|:..:: 
Yeast   121 FTLKHDRKG-RLSMANRGKD------TNGSQFFITTTEEASWLDGKHVVFGQVVDGMDVVNYIQ- 177

  Fly   351 HGTK--NGKISRPLLITHC 367
            |.::  |.|....:.|..|
Yeast   178 HVSRDANDKPLEAVKIAKC 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 35/179 (20%)
CPR2NP_011924.1 cyclophilin 37..197 CDD:412213 37/198 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.