DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and CPR4

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_009995.1 Gene:CPR4 / 850433 SGDID:S000000665 Length:318 Species:Saccharomyces cerevisiae


Alignment Length:264 Identity:47/264 - (17%)
Similarity:95/264 - (35%) Gaps:77/264 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LWL--------GLRLMRIHERKREGDQ-RKREGDQQKRISEQSQSSNLRCPSTITNRSTLGENEV 180
            :||        .|.|.::|.....|.| ..::.|.||:. |.|..:..|...||         |.
Yeast     1 MWLKSLLLCLYSLVLCQVHAAPSSGKQITSKDVDLQKKY-EPSPPATHRGIITI---------EY 55

  Fly   181 FNKYIGWDLDMPDEYFELMRLLRPRIVLHFGLM--------DGRPLGQVVVQLYTEAAPLVVLQF 237
            |:. :...:...|..|||...:.|:.|.:|.::        :|:....:....|.:.        
Yeast    56 FDP-VSKSMKEADLTFELYGTVVPKTVNNFAMLAHGVKAVIEGKDPNDIHTYSYRKT-------- 111

  Fly   238 VRTCLGQRSHEFAVRRIFPRLWVEGYLLSSCKNSLGEASSLSYRDPMEFDTR--VVSHAR----- 295
                        .:.:::|..:::|.:::.      :....:...| :||..  .:.|.|     
Yeast   112 ------------KINKVYPNKYIQGGVVAP------DVGPFTVYGP-KFDDENFYLKHDRPERLA 157

  Fly   296 --YAFVLSCAKEYCVHGFPGGAINFSISFKPLPVARGQRVGFGRVIRG-DKVIEAMEAHGTKNGK 357
              |....|...|:.:.....|  |..:.        |:.|.||::..| |::::|::.  |:..:
Yeast   158 MAYFGPDSNTSEFIITTKADG--NEELD--------GKSVVFGQITSGLDQLMDAIQY--TETDE 210

  Fly   358 ISRP 361
            ..:|
Yeast   211 YGKP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 26/177 (15%)
CPR4NP_009995.1 cyclophilin 67..219 CDD:238194 30/187 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.