DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and AT3G55920

DIOPT Version :10

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_567029.1 Gene:AT3G55920 / 824758 AraportID:AT3G55920 Length:228 Species:Arabidopsis thaliana


Alignment Length:184 Identity:39/184 - (21%)
Similarity:64/184 - (34%) Gaps:33/184 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 IGWDLD--MPDEYFELMRLLRPRIVLHFGLMDGRPLGQVVVQLYTEAAPLVVLQFVRTCLGQRS- 246
            :|.||:  ....||::.             ::|.|.|::::.|:....|.....|...|.|::. 
plant    50 VGEDLEGVTHKVYFDIQ-------------INGSPAGRILIGLFGNIVPKTAENFRSLCTGEKGV 101

  Fly   247 ---------HEFAVRRIFPRLWVEGYLLSSCKNSLGEASSLSYRDPMEFDTRVVSHARYAFVLSC 302
                     ...:..||.|...::|   .......|......|.|....:...:.|....| ||.
plant   102 GNMGKPLYFKGSSFHRIIPGFMIQG---GDFTRGDGRGGESIYGDKFADENFKLKHTGPGF-LSM 162

  Fly   303 AKEYCVHGFPGGAINFSISFKPLPVARGQRVGFGRVIRGDKVIEAMEAHGTKNG 356
            |..    |.......|.|:........|..|.||:|:.|.:|:..:||.|..:|
plant   163 ANS----GPDSNGSQFFITTVTTSWLDGHHVVFGKVLSGMEVVRKIEAQGQDSG 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 Pro_isomerase 218..368 CDD:459694 32/149 (21%)
AT3G55920NP_567029.1 cyclophilin_ABH_like 59..224 CDD:238907 36/175 (21%)

Return to query results.
Submit another query.