DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and CYP5

DIOPT Version :10

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_180557.1 Gene:CYP5 / 817546 AraportID:AT2G29960 Length:201 Species:Arabidopsis thaliana


Alignment Length:156 Identity:37/156 - (23%)
Similarity:60/156 - (38%) Gaps:22/156 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 MDGRPLGQVVVQLYTEAAPLVVLQFVRTCLGQ------------RSHEFAVRRIFPRLWVEGYLL 265
            :||:..|:||:.|:.:|.|.....|...|.|:            :..:|  .||.|...::|   
plant    40 IDGKSAGRVVIGLFGKAVPKTAENFRALCTGEKGVGKSGKPLHYKGSKF--HRIIPSFMIQG--- 99

  Fly   266 SSCKNSLGEASSLSYRDPMEFDTRVVSHARYAFVLSCAKEYCVHGFPGGAINFSISFKPLPVARG 330
            ....:..|......|......:...:.|.... |||.|..    |.......|.|:........|
plant   100 GDFTHGNGMGGESIYGQKFADENFKLKHTGPG-VLSMANS----GEDTNGSQFFITTVTTSWLDG 159

  Fly   331 QRVGFGRVIRGDKVIEAMEAHGTKNG 356
            :.|.||:|::|..|:..:||.|.::|
plant   160 RHVVFGKVVQGMDVVYKIEAEGKQSG 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 Pro_isomerase 218..368 CDD:459694 35/151 (23%)
CYP5NP_180557.1 cyclophilin_ABH_like 32..197 CDD:238907 37/156 (24%)

Return to query results.
Submit another query.