DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and Cwc27

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001347023.1 Gene:Cwc27 / 67285 MGIID:1914535 Length:472 Species:Mus musculus


Alignment Length:160 Identity:37/160 - (23%)
Similarity:57/160 - (35%) Gaps:22/160 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 GQVVVQLYTEAAPLVVLQFVRTCLGQRSHEFAVRRIFPRLWVEGYLLSSCKNSLGEASSLSYRDP 283
            |.:.::|:::.||.....|::.||..........|:.|...|:|    ......|......|..|
Mouse    22 GDIDIELWSKEAPKACRNFIQLCLEAYYDNTIFHRVVPGFIVQG----GDPTGTGTGGESIYGAP 82

  Fly   284 M--EFDTRVVSHARYAFVLSCAKEYCVHGFPGGAINFSISFKPLPVA---RGQRVGFGRVIRGDK 343
            .  ||.:|:..:.|....::.|         |...|.|..|..|..|   ..:...||:| .||.
Mouse    83 FKDEFHSRLRFNRRGLVAMANA---------GPHDNGSQFFFTLGRADELNNKHTIFGKV-TGDT 137

  Fly   344 V---IEAMEAHGTKNGKISRPLLITHCELL 370
            |   :...|.......:...|..|..||:|
Mouse   138 VYNMLRLTEVDIDDEERPRNPHRIKSCEVL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 36/158 (23%)
Cwc27NP_001347023.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 37/160 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 431..472
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.