DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and Ppih

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001103600.1 Gene:Ppih / 66101 MGIID:106499 Length:188 Species:Mus musculus


Alignment Length:147 Identity:31/147 - (21%)
Similarity:54/147 - (36%) Gaps:24/147 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 GRPLGQVVVQLYTEAAPLVVLQFVRTCLGQRSHEF------------AVRRIFPRLWVEGYLLSS 267
            |:.:|::.::|:.:..|.....|.:.|.|    ||            ...|:.....::|   ..
Mouse    21 GQEVGRMKIELFADVVPKTAENFRQFCTG----EFRKDGVPIGYKGSTFHRVIKDFMIQG---GD 78

  Fly   268 CKNSLGEASSLSYRDPMEFDTRVVSHARYAFVLSCAKEYCVHGFPGGAINFSISFKPLPVARGQR 332
            ..|..|...:..||.|...:...:.|:... :||.|..    |.......|.|:........|:.
Mouse    79 FVNGDGTGVASIYRGPFADENFKLRHSAPG-LLSMANS----GPSTNGCQFFITCSKCDWLDGKH 138

  Fly   333 VGFGRVIRGDKVIEAME 349
            |.||::|.|..|:..:|
Mouse   139 VVFGKIIDGLLVMRKIE 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 31/147 (21%)
PpihNP_001103600.1 cyclophilin_ABH_like 11..155 CDD:238907 30/145 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.