DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and Ppib

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_071981.1 Gene:Ppib / 64367 RGDID:620312 Length:208 Species:Rattus norvegicus


Alignment Length:173 Identity:37/173 - (21%)
Similarity:63/173 - (36%) Gaps:19/173 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 PRIV--LHFGLMDG-RPLGQVVVQLYTEAAPLVVLQFVRTCLGQRSHEF---AVRRIFPRLWVEG 262
            |::.  ::|....| .|:|:|...|:.:..|..|..||....|::...:   ...|:.....::|
  Rat    32 PKVTVKVYFDFQIGDEPVGRVTFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQG 96

  Fly   263 YLLSSCKNSLGEASSLSYRDPMEFDTRVVSHARYAFVLSCAKEYCVHGFPGGAINFSISFKPLPV 327
               .......|......|.:....:...:.|....:| |.|..    |.......|.|:......
  Rat    97 ---GDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWV-SMANA----GKDTNGSQFFITTVKTSW 153

  Fly   328 ARGQRVGFGRVIRGDKVIEAMEAHGTKNGKISRPL---LITHC 367
            ..|:.|.||:|:.|..|:..:|  .||.....:||   :|..|
  Rat   154 LDGKHVVFGKVLEGMDVVRKVE--NTKTDSRDKPLKDVIIVDC 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 37/173 (21%)
PpibNP_071981.1 cyclophilin_ABH_like 37..195 CDD:238907 36/168 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.