DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and ZC250.5

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001123073.1 Gene:ZC250.5 / 6418817 WormBaseID:WBGene00045306 Length:204 Species:Caenorhabditis elegans


Alignment Length:208 Identity:38/208 - (18%)
Similarity:73/208 - (35%) Gaps:74/208 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 YFELMRLLRPRIVLHFGLMDGRPLGQVVVQLYTEAAPLVVLQFVRTCLGQRSHEFAVRRI----- 254
            ||::            |...|.|:|:|::|:.......:...||:|..|:..|....::|     
 Worm    33 YFDI------------GFETGVPIGRVIIQMNEALKKNLTELFVKTARGEFVHPSCGKKIEYTGT 85

  Fly   255 -----------------------------FPRLWVEGYLLSSCKNSLGEASSLSYRDPMEFDTRV 290
                                         ..:|:.|....|:.:|:.|:...|    |.:.:..|
 Worm    86 ILHQISTSKNMIMGGDVLNGNGCGRCAPVSRKLFQENNFSSTVQNTRGKVILL----PSDTNPTV 146

  Fly   291 VSHARYAFVLSCAKEYCVHGFPGGAINFSISFKPLPVARGQRVGFGRVIRGDKVIEA-MEAHGTK 354
            .|...|. :|..:....|.|.|                      .|.||.|.:::|. ::.:|::
 Worm   147 FSSLFYV-LLDKSGPSVVDGCP----------------------IGDVIEGIEILETIVKEYGSE 188

  Fly   355 NGKISRPLLITHC 367
            ||:..:.|::.:|
 Worm   189 NGRPGKKLIVHNC 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 36/200 (18%)
ZC250.5NP_001123073.1 cyclophilin 44..200 CDD:381853 32/182 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.