DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and RANBP2

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_005264059.1 Gene:RANBP2 / 5903 HGNCID:9848 Length:3258 Species:Homo sapiens


Alignment Length:175 Identity:44/175 - (25%)
Similarity:74/175 - (42%) Gaps:14/175 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 ELMRLLRPRIVLHFGL-MDGRPLGQVVVQLYTEAAPLVVLQFVRTCLGQRSHEF---AVRRIFPR 257
            ||.:...|  |:.|.: .||.|||::.::|::...|.....|...|.|::...|   ...|:.|.
Human  3091 ELSKETNP--VVFFDVCADGEPLGRITMELFSNIVPRTAENFRALCTGEKGFGFKNSIFHRVIPD 3153

  Fly   258 LWVEGYLLSSCKNSLGEASSLSYRDPMEFDTRVVSHARYAFVLSCAKEYCVHGFPGGAINFSISF 322
            ...:|..::....:.|::   .|.|..|.:...|.|.... :||.|.:    |.......|.|:.
Human  3154 FVCQGGDITKHDGTGGQS---IYGDKFEDENFDVKHTGPG-LLSMANQ----GQNTNNSQFVITL 3210

  Fly   323 KPLPVARGQRVGFGRVIRGDKVIEAMEAHGTKNGKISRPLLITHC 367
            |.......:.|.||.|..|...::.:|:.|:..|.:.|.:.||.|
Human  3211 KKAEHLDFKHVVFGFVKDGMDTVKKIESFGSPKGSVCRRITITEC 3255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 42/169 (25%)
RANBP2XP_005264059.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.