DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and PPID

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_005029.1 Gene:PPID / 5481 HGNCID:9257 Length:370 Species:Homo sapiens


Alignment Length:178 Identity:42/178 - (23%)
Similarity:69/178 - (38%) Gaps:26/178 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 PRIVLHFGLMDGRPLGQVVVQLYTEAAPLVVLQFVRTCLGQR--SHEFA---------VRRIFPR 257
            ||:.....: .|..:|::|::|:.:..|.....|...|.|::  .|...         ..||..:
Human    16 PRVFFDVDI-GGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKGCPFHRIIKK 79

  Fly   258 LWVEGYLLSSCKNSLGEASSLSYRDPMEFDTRVVSHARYAFVLSCAKEYCVHGFPGGAINFSISF 322
            ..::|   ....|..|......|.:..|.:.....|.|.. :||.|..    |.......|.|:.
Human    80 FMIQG---GDFSNQNGTGGESIYGEKFEDENFHYKHDREG-LLSMANA----GRNTNGSQFFITT 136

  Fly   323 KPLPVARGQRVGFGRVIRG---DKVIEAMEAHGTKNGKISRPLLITHC 367
            .|.|...|:.|.||:||:|   .:::|.:|..|.|..|:   .:|..|
Human   137 VPTPHLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKL---CVIAEC 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 42/178 (24%)
PPIDNP_005029.1 cyclophilin_ABH_like 16..182 CDD:238907 42/178 (24%)
Chaperone activity. /evidence=ECO:0000250 185..215
PLN03088 192..>362 CDD:330826
Interaction with HSP90AB1. /evidence=ECO:0000250 214..370
TPR repeat 224..267 CDD:276809
TPR repeat 272..302 CDD:276809
TPR repeat 307..333 CDD:276809
TPR repeat 341..364 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.