DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and PPIL1

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_057143.1 Gene:PPIL1 / 51645 HGNCID:9260 Length:166 Species:Homo sapiens


Alignment Length:133 Identity:30/133 - (22%)
Similarity:50/133 - (37%) Gaps:26/133 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 LGQVVVQLYTEAAPLVVLQFVRTC-----LGQRSHEFAVR--RIFPRLWVEGYLLSSCKNSLGEA 275
            :|.:|::||.:.||       :||     |.:|.:....:  ||.....::|.  .......|.|
Human    20 MGIIVLELYWKHAP-------KTCKNFAELARRGYYNGTKFHRIIKDFMIQGG--DPTGTGRGGA 75

  Fly   276 S--SLSYRDPMEFDTRVVSHARYAFVLSCAKEYCVHGFPGGAINFSISFKPLPVARGQRVGFGRV 338
            |  ...:.|.:..|.:...    |.:|:.|..    |.......|.::..|.....|:...||||
Human    76 SIYGKQFEDELHPDLKFTG----AGILAMANA----GPDTNGSQFFVTLAPTQWLDGKHTIFGRV 132

  Fly   339 IRG 341
            .:|
Human   133 CQG 135

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 30/133 (23%)
PPIL1NP_057143.1 cyclophilin_SpCYP2_like 15..161 CDD:238903 30/133 (23%)
Cyclosporin A binding. /evidence=ECO:0000305|PubMed:16595688 54..65 2/10 (20%)