DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and ppif

DIOPT Version :10

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001244029.1 Gene:ppif / 493394 XenbaseID:XB-GENE-1008626 Length:200 Species:Xenopus tropicalis


Alignment Length:145 Identity:29/145 - (20%)
Similarity:50/145 - (34%) Gaps:39/145 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FLWLLSMAICPDAMVNATSGRKDKY---CESRDSKE----LIARCEEGDIRH-DF------IKNV 69
            |..:|..:||.|....|.....:||   .::|:.:.    |:..||....:. ||      :...
 Frog   696 FAQVLKRSICLDQNTQAWCDTCEKYQPTIQTRNIRHLPDILVINCEVNSSKEADFWRMQAEVAFK 760

  Fly    70 VSAEKMQQPLSTRR----------SSDKKLSVVPEADEQSTVQSTIHSIRPTILRQPSV------ 118
            ::.:|....:|..:          .|.:.:.|.|..:|...|.... |||..:.:...:      
 Frog   761 MAVKKHGGEISKNKEFALADWKELGSPEGVLVCPSIEELKNVWLPF-SIRMKMTKNKGLDVCNWT 824

  Fly   119 --------PVRLEEE 125
                    |.|.|||
 Frog   825 DGDEMQWGPARAEEE 839

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 Pro_isomerase 218..368 CDD:459694
ppifNP_001244029.1 cyclophilin_ABH_like 39..197 CDD:238907
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.