DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and CG5808

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster


Alignment Length:159 Identity:33/159 - (20%)
Similarity:55/159 - (34%) Gaps:30/159 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SAASRVSTFTERHHRRVQLSRNKLYLQRLSRATSLVHKRPPLMNVKTQSGFDVLHEDARIFLERT 76
            |:|.|.....:||..:.:....| .|||.:|:.....|  .:...|......|          |.
  Fly   376 SSAERRKAREQRHQEQSERDVRK-NLQRRTRSKEKDEK--SVYRSKKSQNESV----------RE 427

  Fly    77 NANVRLLLNLSKIKRTKGTI--------DFVEGPPLIPQSALPQMLQRLDRVQRHNLWLGLRLMR 133
            |:|.....|..:..|::...        |..|..|..|:..|.:..:..|:.:|.         |
  Fly   428 NSNRERNRNEKRSSRSRDATHRRYSRSRDREERRPSRPRDQLGRRSRSRDQKERR---------R 483

  Fly   134 IHERKREGDQRKREGDQQKRISEQSQSSN 162
            ...|::...:|.|..||..:...|::..|
  Fly   484 SRPREQNERRRSRSRDQTGKRPTQNRDRN 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902
RRM <237..445 CDD:223796 18/81 (22%)
RRM_PPIL4 237..319 CDD:240681
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.