DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and ppid

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_988984.1 Gene:ppid / 394581 XenbaseID:XB-GENE-855598 Length:370 Species:Xenopus tropicalis


Alignment Length:180 Identity:35/180 - (19%)
Similarity:67/180 - (37%) Gaps:30/180 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 PRIVLHFGLMDGRPLGQVVVQLYTEAAPLVVLQFVRTCLGQRS----------------HEFAVR 252
            |::.|...: .|..:|::|::|:.:..|.....|.....|::.                |     
 Frog    16 PKVFLDVEI-GGERVGRIVLELFADVVPKTAENFRALSTGEKGIGQSTGKPLHFKGCPFH----- 74

  Fly   253 RIFPRLWVEGYLLSSCKNSLGEASSLSYRDPMEFDTRVVSHARYAFVLSCAKEYCVHGFPGGAIN 317
            ||..:..::   .....|..|......|.:..|.:.....|.:.. :||.|..    |.......
 Frog    75 RIIKKFMIQ---CGDFSNQNGTGGESIYGEKFEDENFHYKHDKEG-LLSMANA----GPNTNGSQ 131

  Fly   318 FSISFKPLPVARGQRVGFGRVIRGDKVIEAMEAHGTKNGKISRPLLITHC 367
            |.|:..|.....|:.|.||:|::|..:::.:|....|:.|.::..:|..|
 Frog   132 FFITTVPTAHLDGKHVVFGQVLKGYGIVKMLENVEVKDEKPAKMCVIAEC 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 35/180 (19%)
ppidNP_988984.1 cyclophilin_ABH_like 16..182 CDD:238907 35/180 (19%)
3a0801s09 192..>362 CDD:273380
TPR repeat 223..267 CDD:276809
TPR repeat 272..302 CDD:276809
TPR repeat 307..335 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.