DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and ppia

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_988875.1 Gene:ppia / 394470 XenbaseID:XB-GENE-5778000 Length:164 Species:Xenopus tropicalis


Alignment Length:167 Identity:39/167 - (23%)
Similarity:67/167 - (40%) Gaps:12/167 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 PRIVLHFGLMDGRPLGQVVVQLYTEAAPLVVLQFVRTCLGQRSHEF---AVRRIFPRLWVEGYLL 265
            ||:..... :||.|:|:::::|.::..|.....|...|..::...:   ...||.|....:|   
 Frog     4 PRVFFDIA-VDGCPMGRIIMELRSDVVPKTAENFRALCTNEKGFGYKNSGFHRIIPEFMCQG--- 64

  Fly   266 SSCKNSLGEASSLSYRDPMEFDTRVVSHARYAFVLSCAKEYCVHGFPGGAINFSISFKPLPVARG 330
            ....|..|......|.:....:...:.|.... :||.|..    |.......|.|.........|
 Frog    65 GDFTNHNGTGGKSIYGNKFADENFQLRHTGPG-ILSMANA----GANTNGSQFFICTAKTSWLDG 124

  Fly   331 QRVGFGRVIRGDKVIEAMEAHGTKNGKISRPLLITHC 367
            :.|.||.||.|..|:..||..|:::||.::.::|.:|
 Frog   125 KHVVFGTVIDGMDVVRNMEKLGSQSGKPAKKIVIANC 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 39/167 (23%)
ppiaNP_988875.1 cyclophilin_ABH_like 4..162 CDD:238907 39/167 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.