DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and ppil2

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_957285.2 Gene:ppil2 / 393966 ZFINID:ZDB-GENE-040426-1096 Length:524 Species:Danio rerio


Alignment Length:322 Identity:61/322 - (18%)
Similarity:109/322 - (33%) Gaps:70/322 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 MNVKTQSGFDVL------HEDARIFLERTNANVRLLLNLSKIKRTKGTIDFVEGPPLIPQSALPQ 112
            :|:||:|..|:|      .:|.....:.||.:...:.|...:|.....:|    |........|.
Zfish   134 LNIKTKSYKDLLTDEPFTRQDLITLQDPTNLDKFNVSNFFHVKNNMKVLD----PDEEKAKQDPS 194

  Fly   113 MLQRLDRVQRHNLWLGLRLMRIHERKREGDQ----RKREGDQQK------------RISEQSQSS 161
            .     .::..||.....|..:: |..:||:    ..:|.:.:|            |:| .|.:|
Zfish   195 Y-----HLKSTNLETRETLAELY-RDYKGDELLASTMKEPEAKKTDKFNAAHYSTGRVS-ASFTS 252

  Fly   162 NLRCPSTITNRSTLGENEVFNKYI---GWDLDMPDEYFELMRLLRPRIVLHFGLMDGRPLGQVVV 223
            ....|:|......:.::.|..:|:   |:                  :.||..      .|.:.|
Zfish   253 TAMAPATNHEADAIADDAVRYQYVKKKGY------------------VRLHTN------KGDLNV 293

  Fly   224 QLYTEAAPLVVLQFVRTCLGQRSHEFAVRRIFPRLWVEGYLLSSCKNSLGEASSLSYRDPMEFDT 288
            :|:.:..|.....|::.|...........|......::|    ......|......:..|.:.:.
Zfish   294 ELHCDKVPKAGENFIKLCKKGYYDGTVFHRSIRNFMIQG----GDPTGTGTGGESFWGKPFKDEF 354

  Fly   289 RV-VSHARYAFVLSCAKEYCVHGFPGGAINFSISFKPLPVARGQRVGFGRVIRGDKVIEAME 349
            |. :||.... :||.|..    |.......|.|:|:.......:...||||:.|.:.:.|||
Zfish   355 RPNLSHTGRG-ILSMANS----GPNTNKSQFFITFRSCAYLDRKHSVFGRVVGGLETLSAME 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 30/148 (20%)
ppil2NP_957285.2 Ubox 42..96 CDD:128780
cyclophilin_RING 281..440 CDD:238904 30/164 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.