DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and CG2852

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_611695.1 Gene:CG2852 / 37591 FlyBaseID:FBgn0034753 Length:205 Species:Drosophila melanogaster


Alignment Length:146 Identity:31/146 - (21%)
Similarity:55/146 - (37%) Gaps:19/146 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 GRPLGQVVVQLYTEAAPLVVLQFVRTCL-----GQRSHEFAVRRIFPRLWVEGYLLSSCKNSLGE 274
            |.|.|::.:.|:.:..|..|..|....|     |.:..:|  .||.....::|   .......|.
  Fly    39 GEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKF--HRIIKDFMIQG---GDFTKGDGT 98

  Fly   275 ASSLSYRDPMEFDTRVVSH--ARYAFVLSCAKEYCVHGFPGGAINFSISFKPLPVARGQRVGFGR 337
            .....|.:..|.:...:.|  |.:..:.:..|:      ..|: .|.|:.|......|:.|.||:
  Fly    99 GGRSIYGERFEDENFKLKHYGAGWLSMANAGKD------TNGS-QFFITTKQTSWLDGRHVVFGK 156

  Fly   338 VIRGDKVIEAMEAHGT 353
            ::.|..|:..:|...|
  Fly   157 ILSGMNVVRQIENSAT 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 31/146 (21%)
CG2852NP_611695.1 cyclophilin 30..188 CDD:294131 31/146 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.