DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and cyp33

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster


Alignment Length:245 Identity:48/245 - (19%)
Similarity:85/245 - (34%) Gaps:52/245 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 WLGLRLMRIHERKREGDQRKREGDQQKRISEQSQSSNLRCPSTITNRSTLGENEVFNKYIGWDLD 190
            ||         :|..|...:.||        :.::..:..||  |..:.:.:.|..|        
  Fly   101 WL---------QKHAGATLQPEG--------EPEAEKVETPS--TGPAVIEKAEKRN-------- 138

  Fly   191 MPDEYFELMRLLRPRIVLHFGLMDGRPLGQVVVQLYTEAAPLVVLQFVRTCLGQRSHEF---AVR 252
             |..:|::.             :.|...|::|:.|..:..|.....|.:.|..::.:.:   :..
  Fly   139 -PQVFFDIR-------------IGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFH 189

  Fly   253 RIFPRLWVEGYLLSSCKNSLGEASSLSYRDPMEFDTRVVSHARYAFVLSCAKEYCVHGFPGGAIN 317
            |:.|....:|   ....|:.|......|......:...:.|..:. .||.|..    |.......
  Fly   190 RVIPEFMCQG---GDFTNNNGTGGKSIYGKKFNDENFNLKHNSFG-TLSMANS----GANTNGSQ 246

  Fly   318 FSISFKPLPVARGQRVGFGRVIRGDKVIEAMEAHGTKNGKISRPLLITHC 367
            |.|..........:.|.||.||.|.:|:..||..|:|:|..|:.::|..|
  Fly   247 FFICTTKTDWLDNKHVVFGHVISGAEVVRKMERCGSKSGTPSQKIVIYSC 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 35/168 (21%)
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 37/179 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.