DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and CG7747

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster


Alignment Length:333 Identity:59/333 - (17%)
Similarity:117/333 - (35%) Gaps:76/333 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 FDVLHEDARIFLERTNANVRLLLNLSKIK-RTKGTIDFVEGPPLIPQSAL----PQMLQRLDRVQ 121
            |....:::.|....|..||.....:.::. :||...|.|:..|...:..:    ||.|::.|...
  Fly   110 FKPFSKNSHIVAVATTGNVYCWEAIDQLNIKTKNWKDLVDDTPFQRKDIITIQDPQKLEKYDIST 174

  Fly   122 RHNLWLGLRLMRIHERKREGDQRKREGDQQKRI--------------------SEQSQSSNLR-- 164
            .:::...||::      .|.:|::|:.....||                    :|:..|::.|  
  Fly   175 FYHIKKNLRVL------TEEEQQERKNPASGRIKTMNLETKETLEQLQQDYQPAEEEASTSKRTA 233

  Fly   165 ------------CPSTITNRSTLGENEVFNKYIGWDLDMPDEYFELMRLLRPRIVLHFGLMDGRP 217
                        ..::.|:.:.:..:::....|..||   .:|..:.:....|:..:.|     |
  Fly   234 DKFNAAHYSTGAVAASFTSTAMVPVSQIEAAIIDDDL---VKYERVKKKGYVRLNTNLG-----P 290

  Fly   218 LGQVVVQLYTEAAPLVVLQFVRTCLGQRSHEFAVRRIFPRLWVEGYLLSSCKNSLGEAS------ 276
            |.   ::|:.:..|.....|::.|.....:.....|......|:|      .:..|..|      
  Fly   291 LN---LELFCDQTPRACDNFIKHCANGYYNNVMFHRSIRNFIVQG------GDPTGSGSGGESIW 346

  Fly   277 SLSYRDPMEFDTRVVSHARYAFVLSCAKEYCVHGFPGGAINFSISFKPLPVARGQRVGFGRVIRG 341
            ...:.|  ||...:....|  .|||.|..    |.......|.|:::......|:...||:::.|
  Fly   347 GKKFED--EFKPNLTHTGR--GVLSMANS----GPNTNGSQFFITYRSCKHLDGKHTIFGKLVGG 403

  Fly   342 DKVIEAME 349
            ...::.||
  Fly   404 LDTLQKME 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 30/153 (20%)
CG7747NP_611113.1 RING 25..238 CDD:302633 24/133 (18%)
cyclophilin_RING 281..439 CDD:238904 30/153 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.