DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and Ppil2

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001017383.1 Gene:Ppil2 / 360746 RGDID:1309484 Length:521 Species:Rattus norvegicus


Alignment Length:300 Identity:57/300 - (19%)
Similarity:100/300 - (33%) Gaps:73/300 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 EDARIFLERTNANVR-LLLNLSKIKRTKGTIDFVEGPPLIPQSALPQMLQRLDRVQRHNLWLGLR 130
            :|...:|:.|||..| .|..|.|        :| :|..::..:..|...:::|::...:...|  
  Rat   191 QDPSYYLKNTNAETRETLQELYK--------EF-KGDEILAATMKPPEKKKVDQLNAAHYSTG-- 244

  Fly   131 LMRIHERKREGDQRKREGDQQKRISEQSQSSNLRCPSTITNRSTLGENEV---FNKYIGWDLDMP 192
                                  ::| .|.:|....|.|....:.:.|:.:   |.|..|:     
  Rat   245 ----------------------KVS-ASFTSTAMVPETTHEAAVIDEDVLRYQFVKKKGY----- 281

  Fly   193 DEYFELMRLLRPRIVLHFGLMDGRPLGQVVVQLYTEAAPLVVLQFVRTCLGQRSHEFAVRRIFPR 257
                         :.||..      .|.:.::|:.:..|.....|::.|..|........|....
  Rat   282 -------------VRLHTN------KGDLNLELHCDLTPKTCENFIKLCKKQYYDGTIFHRSIRN 327

  Fly   258 LWVEGYLLSSCKNSLGEASSLSYRDPMEFDTRV-VSHARYAFVLSCAKEYCVHGFPGGAINFSIS 321
            ..::|    ......|......:..|.:.:.|. :||.... |||.|..    |.......|.|:
  Rat   328 FVIQG----GDPTGTGTGGESYWGKPFKDEFRPNLSHTGRG-VLSMANS----GPNTNKSQFFIT 383

  Fly   322 FKPLPVARGQRVGFGRVIRGDKVIEAMEAHGTKNGKISRP 361
            |:.......:...||||:.|...:.||| :...:.|..||
  Rat   384 FRSCAYLDKKHTIFGRVVGGFDTLTAME-NVESDPKTDRP 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 33/159 (21%)
Ppil2NP_001017383.1 Ubox 42..96 CDD:128780
cyclophilin_RING 281..440 CDD:238904 33/175 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.