DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and CG17266

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster


Alignment Length:188 Identity:39/188 - (20%)
Similarity:72/188 - (38%) Gaps:52/188 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 VLHFGLMDG-RPLGQVVVQLYTEAAPLVVLQFVRTCLGQRSHE--------FAVRRIFPRLWVEG 262
            |:.|.:..| ..:|:::.:|:.:..|.....|.:.|.|:...:        .:..|:.....::|
  Fly    18 VVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKDFMIQG 82

  Fly   263 ---------YLLSSCKNSLGEAS-SLSYRDPMEFDTRVVSHARYA-------FVLSCAKEYCVHG 310
                     .:.|...|:.|:.: :|.:..|     .::|.|...       |.::|||  |   
  Fly    83 GDFVQGDGTGVTSIYGNTFGDENFTLKHDSP-----GLLSMANSGKETNGCQFFITCAK--C--- 137

  Fly   311 FPGGAINFSISFKPLPVARGQRVGFGRVIRGDKVIEAMEAHGT-KNGKISRPLLITHC 367
                  ||         ..|:.|.||||:.|..::..:|...| .|.|...|:.|:.|
  Fly   138 ------NF---------LDGKHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQC 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 39/188 (21%)
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 39/188 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.