DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and Cyp1

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_523366.2 Gene:Cyp1 / 32595 FlyBaseID:FBgn0004432 Length:227 Species:Drosophila melanogaster


Alignment Length:206 Identity:45/206 - (21%)
Similarity:88/206 - (42%) Gaps:18/206 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 ITNRS-TLGEN--EVFNKYIGWDLDMPDEYFELMRL-LRPRIVLHFGLMDGRPLGQVVVQLYTEA 229
            :.|:| ||..:  .|....:.:.:.:..||.:..:: ..||:.... ..|..|||::|::|.::.
  Fly    28 LANKSITLASSACSVNRGQLQFGIQIVREYSKASKMSTLPRVFFDM-TADNEPLGRIVMELRSDV 91

  Fly   230 APLVVLQFVRTCLGQRSHEF---AVRRIFPRLWVEGYLLSSCKNSLGEASSLSYRDPME-FDTRV 290
            .|.....|...|.|::...:   ...|:.|....:|...:: .|..|..|....:.|.| |:.:.
  Fly    92 VPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGDFTN-HNGTGGKSIYGNKFPDENFELKH 155

  Fly   291 VSHARYAFVLSCAKEYCVHGFPGGAINFSISFKPLPVARGQRVGFGRVIRGDKVIEAMEAHGTKN 355
            ....    :||.|..    |.......|.|..........:.|.||.|:.|..|::.:|::|:::
  Fly   156 TGSG----ILSMANA----GANTNGSQFFICTVKTAWLDNKHVVFGEVVEGLDVVKKIESYGSQS 212

  Fly   356 GKISRPLLITH 366
            ||.|:.:::.:
  Fly   213 GKTSKKIIVAN 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 38/168 (23%)
Cyp1NP_523366.2 cyclophilin_ABH_like 67..225 CDD:238907 38/167 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.