DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and Ppie

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001382655.1 Gene:Ppie / 298508 RGDID:1311411 Length:301 Species:Rattus norvegicus


Alignment Length:254 Identity:53/254 - (20%)
Similarity:92/254 - (36%) Gaps:36/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 RVQRHNLWLGLRLMRIHERKREGDQRK--REGDQQKRISEQSQSSNLRCPSTITNRSTLGENEVF 181
            |..|.||   .:.|||    :||..|.  .:.|..|:.|.::...|.........::...|.|..
  Rat    75 RTIRVNL---AKPMRI----KEGSSRPVWSDDDWLKKFSGKTLEENKEEEGPEPPKAEAPEGEPA 132

  Fly   182 NKYIGWDLDMPDEYFELMRLLRPRIVLHFGLMDGRPLGQVVVQLYTEAAPLVVLQFVRTCLGQRS 246
            .|..   ...|..|.::.             :..:|.|::.:.|.::..|:....|...|..::.
  Rat   133 AKKA---RSNPQVYMDIK-------------IGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKG 181

  Fly   247 HEF---AVRRIFPRLWVEGYLLSSCKNSLGEASSLSYRDPMEFDTRVVSHARYAFVLSCAKEYCV 308
            ..|   :..||.|:...:|   ....|..|......|....:.:..::.|.... :||.|..   
  Rat   182 FGFKGSSFHRIIPQFMCQG---GDFTNHNGTGGKSIYGKKFDDENFILKHTGPG-LLSMANS--- 239

  Fly   309 HGFPGGAINFSISFKPLPVARGQRVGFGRVIRGDKVIEAMEAHGTKNGKISRPLLITHC 367
             |.......|.::........|:.|.||.:..|..|:..:||.|:|:||..:.::|..|
  Rat   240 -GPNTNGSQFFLTCDKTDWLDGKHVVFGEITDGLDVLRQIEAQGSKDGKPKQKVIIADC 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 34/168 (20%)
PpieNP_001382655.1 RRM_PPIE 8..82 CDD:409783 4/9 (44%)
cyclophilin_ABH_like 140..298 CDD:238907 36/179 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.