DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and PPIL2

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_011528343.1 Gene:PPIL2 / 23759 HGNCID:9261 Length:616 Species:Homo sapiens


Alignment Length:350 Identity:63/350 - (18%)
Similarity:116/350 - (33%) Gaps:84/350 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 FDVLHEDARIFLERTNANVRLLLNLSKIK-RTKGTIDFVEGPPLIPQSAL----PQMLQRLDRVQ 121
            |.|...:..|...||..||.....:.::. :.|...|.:...|...|..:    |..|.:.:...
Human   107 FTVFTNNTHIVAVRTTGNVYAYEAVEQLNIKAKNFRDLLTDEPFSRQDIITLQDPTNLDKFNVSN 171

  Fly   122 RHNLWLGLRLMRIHERKREGD-------------------QRKREGD----------QQKRISE- 156
            .:::...::::...|.|.:.|                   .::.:||          ::|::.: 
Human   172 FYHVKNNMKIIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAPEKKKVDKL 236

  Fly   157 -----------QSQSSNLRCPSTITNRSTLGENEV---FNKYIGWDLDMPDEYFELMRLLRPRIV 207
                       .|.:|....|.|....:.:.|:.:   |.|..|:                  :.
Human   237 NAAHYSTGKVSASFTSTAMVPETTHEAAAIDEDVLRYQFVKKKGY------------------VR 283

  Fly   208 LHFGLMDGRPLGQVVVQLYTEAAPLVVLQFVRTCLGQRSHEFAVRRIFPRLWVEGYLLSSCKNSL 272
            ||..      .|.:.::|:.:..|.....|:|.|   :.|.:. ..||.|......:........
Human   284 LHTN------KGDLNLELHCDLTPKTCENFIRLC---KKHYYD-GTIFHRSIRNFVIQGGDPTGT 338

  Fly   273 GEASSLSYRDPMEFDTRV-VSHARYAFVLSCAKEYCVHGFPGGAINFSISFKPLPVARGQRVGFG 336
            |......:..|.:.:.|. :||.... :||.|..    |.......|.|:|:.......:...||
Human   339 GTGGESYWGKPFKDEFRPNLSHTGRG-ILSMANS----GPNSNRSQFFITFRSCAYLDKKHTIFG 398

  Fly   337 RVIRGDKVIEAMEAHGTKNGKISRP 361
            ||:.|..|:.||| :...:.|..||
Human   399 RVVGGFDVLTAME-NVESDPKTDRP 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 35/159 (22%)
PPIL2XP_011528343.1 RING-Ubox_PPIL2 38..110 CDD:319577 1/2 (50%)
RING_Ubox 100..159 CDD:388418 11/51 (22%)
U-box domain, a modified RING finger 103..146 CDD:319361 9/38 (24%)
cyclophilin_RING 281..440 CDD:238904 35/175 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.