DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and cyn-8

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_509507.1 Gene:cyn-8 / 181136 WormBaseID:WBGene00000884 Length:447 Species:Caenorhabditis elegans


Alignment Length:165 Identity:40/165 - (24%)
Similarity:75/165 - (45%) Gaps:18/165 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 MDGRPLGQVVVQLYTEAAPLVVLQFVRTC---LGQRSHEFAVRR--IFPRLWVEGYLL--SSCKN 270
            ::|.|.|::|..|:....|..|..|...|   ||:.:..:|..:  :|.|: ::|:::  ....:
 Worm    17 INGEPAGRIVFSLWNHCCPRTVENFRAFCTGELGKMNGHYASYQGSVFHRV-IKGFMIQGGDITH 80

  Fly   271 SLGEASSLSYRDPMEFDTRVVSHARYAFVLSCAKEYCVHGFPGGAINFSISFKPLPVARGQRVGF 335
            ..|......|....:.:...:.|.: .::||.|.    .|.......|.|:.:.:|...|:...|
 Worm    81 GNGTGGYSIYGRTFDDENLALKHKK-PYLLSMAN----RGPDTNGSQFFITSEEVPHLDGKHCVF 140

  Fly   336 GRVIRGDKVIEAMEAHGTKNGKISRPLL---ITHC 367
            |.||:|.:|::|:|  ..:.|...:|:.   ||||
 Worm   141 GEVIKGVEVVKAIE--NLETGNEDKPVCKVEITHC 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 40/165 (24%)
cyn-8NP_509507.1 cyclophilin 10..174 CDD:412213 40/165 (24%)
ATP-synt_Fo_b <324..391 CDD:349951
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.