DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and cyn-9

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_497745.1 Gene:cyn-9 / 175471 WormBaseID:WBGene00000885 Length:309 Species:Caenorhabditis elegans


Alignment Length:171 Identity:40/171 - (23%)
Similarity:75/171 - (43%) Gaps:28/171 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 MDGRPLGQVVVQLYTEAAPLVVLQFVRTCLGQ-------------RSHEFAVRRIFPRLWVEGYL 264
            :|...:|::.::|:.|.||.....|...|.|:             :.:||  .||..:..::|..
 Worm    13 VDENLIGRIEIRLFVEDAPKTCENFRALCTGEVGMTPNNKARLHYKQNEF--HRIVKKFMIQGGD 75

  Fly   265 LSSCKNSLGEASSLSYRDPMEFDTRVVSHARYAFVLSCAKEYCVHGFPGGAINFSISFKPLPVAR 329
            ::......|.:....|.|..:|.   :.|:| .::||.|.:    |....:..|.|:....|...
 Worm    76 ITEGDGRGGFSIYGRYFDDEKFK---LKHSR-PYLLSMANK----GPNSNSSQFFITTAAAPHCN 132

  Fly   330 GQRVGFGRVIRGDKVIEAMEAHGTKNGKISRPL---LITHC 367
            |:.|.||.|::|..|::.::.....:.  |:||   ||::|
 Worm   133 GKHVVFGEVVKGQNVVDYIDNLAVDDK--SKPLAKVLISNC 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 40/171 (23%)
cyn-9NP_497745.1 cyclophilin 6..172 CDD:294131 40/171 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.