DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and cyn-11

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_495855.1 Gene:cyn-11 / 174394 WormBaseID:WBGene00000887 Length:183 Species:Caenorhabditis elegans


Alignment Length:190 Identity:40/190 - (21%)
Similarity:70/190 - (36%) Gaps:29/190 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 DEYFELMRLLRPRIVLHFGLMDGRPLGQVVVQLYTEAAPLVVLQFVRTCLGQRSHE--------F 249
            |::.|.:|.....||.......|.|:|.:|::|:.:..|.....|.:.|.|:...:        .
 Worm     5 DKFAEQLRHPDNPIVFLEVTAGGAPIGTIVIELFADVTPRTAENFRQFCTGEYKKDGVPNGYKNC 69

  Fly   250 AVRRIFPRLWVEGYLLSSCKNSLGEASSL------SYRDPMEFDTRVVSHARYAFVLSCAKEYCV 308
            ...|:.....::|.  ..|.   |:.:.|      .:||. .|:.:.:...    :||.|..   
 Worm    70 TFHRVIKDFMIQGG--DFCN---GDGTGLMSIYGSKFRDE-NFELKHIGPG----MLSMANA--- 121

  Fly   309 HGFPGGAINFSISFKPLPVARGQRVGFGRVIRGDKVIEAMEAHGT-KNGKISRPLLITHC 367
             |.......|.|:.........:.|.||||:.|...:..:|...| .|.|...|:::..|
 Worm   122 -GSDTNGCQFFITCAKTDFLDNKHVVFGRVLDGMLTVRKIENVPTGANNKPKLPIVVVQC 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 37/180 (21%)
cyn-11NP_495855.1 cyclophilin 12..183 CDD:294131 38/183 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.