DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15767 and PPIE

DIOPT Version :9

Sequence 1:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001181936.1 Gene:PPIE / 10450 HGNCID:9258 Length:314 Species:Homo sapiens


Alignment Length:307 Identity:60/307 - (19%)
Similarity:102/307 - (33%) Gaps:88/307 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LHEDARIFLERTNANV----RLLLNLSKIKRTKGTIDFVEGPPLIPQSALPQMLQRLDRVQRHNL 125
            |.|||...::..|.:.    .:.:||:|..|.|      ||      |:.|        |...:.
Human    56 LAEDAAAAIDNMNESELFGRTIRVNLAKPMRIK------EG------SSRP--------VWSDDD 100

  Fly   126 WL----GLRLMRIHERKRE--GDQRKREGDQQKRISEQSQSSNLRCPSTITNRSTLGENEVFNKY 184
            ||    |..|   .|.|.|  .:..|.|..:.:.|:::::|:                       
Human   101 WLKKFSGKTL---EENKEEEGSEPPKAETQEGEPIAKKARSN----------------------- 139

  Fly   185 IGWDLDMPDEYFELMRLLRPRIVLHFGLMDGRPLGQVVVQLYTEAAPLVVLQFVRTCLGQRSHEF 249
                   |..|.::.             :..:|.|::.:.|.::..|:....|...|..::...|
Human   140 -------PQVYMDIK-------------IGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGF 184

  Fly   250 ---AVRRIFPRLWVEGYLLSSCKNSLGEASSLSYRDPMEFDTRVVSHARYAFVLSCAKEYCVHGF 311
               :..||.|:...:|   ....|..|......|....:.:..::.|.... :||.|..    |.
Human   185 KGSSFHRIIPQFMCQG---GDFTNHNGTGGKSIYGKKFDDENFILKHTGPG-LLSMANS----GP 241

  Fly   312 PGGAINFSISFKPLPVARGQRVGFGRVIRGDKVIEAME-AHGTKNGK 357
            ......|.::........|:.|.||.|..|..|:..:| |..||..|
Human   242 NTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEVAPDTKASK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 32/159 (20%)
PPIENP_001181936.1 RRM <5..>84 CDD:223796 7/27 (26%)
RRM_PPIE 8..80 CDD:240793 5/23 (22%)
cyclophilin_ABH_like 140..279 CDD:238907 29/159 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.