DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and TCEAL3

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_001006934.1 Gene:TCEAL3 / 85012 HGNCID:28247 Length:200 Species:Homo sapiens


Alignment Length:186 Identity:51/186 - (27%)
Similarity:80/186 - (43%) Gaps:41/186 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 YQSESDGEQAETKPEIEAQPEVEAQPEAEAQPEAEPQLEVEPQPEVESQPEVESQPEVEAQPEVE 306
            |.......:.|.|||.|.:|:.|.:.:.|.:|:.|.:.|.|.:.|.|.:|..|.|.|.|...|.:
Human     5 YNKNEGNLENEGKPEDEVEPDDEGKSDEEEKPDVEGKTECEGKREDEGEPGDEGQLEDEGSQEKQ 69

  Fly   307 PQSEVESQPEAESHSEPETQAEVEAQPEVESLPEAESQPEAESQPEREPEVEAEKISDNEVDTTE 371
            .:||.|.:|:.|  .:|.:||:.|:||..     ||.:|..:..|.:     |::.:|...|.: 
Human    70 GRSEGEGKPQGE--GKPASQAKPESQPRA-----AEKRPAEDYVPRK-----AKRKTDRGTDDS- 121

  Fly   372 ASLMETLVEGIEDGLTAAMDNLVPEELAEASDKQETELESEDQQ---SPVTEAIEE 424
                                   |::..|  |.||..|.||:..   ..|:.|.||
Human   122 -----------------------PKDSQE--DLQERHLSSEEMMRECGDVSRAQEE 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844
TCEAL3NP_001006934.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..200 51/186 (27%)
Na_Ca_ex <2..>104 CDD:332332 35/105 (33%)
BEX 81..173 CDD:309604 26/110 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.