DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and SOL1

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_974126.1 Gene:SOL1 / 843499 AraportID:AT1G71696 Length:491 Species:Arabidopsis thaliana


Alignment Length:371 Identity:82/371 - (22%)
Similarity:132/371 - (35%) Gaps:92/371 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   819 QAYHRLEDIHGFIDYMAKTYPDICSTEIIGYSVEKRPLKILKISNGNAR---NPGIWIDGGMHAR 880
            :.|...:|:...:....|....|.....||.||...||.:::||:....   .|.....|.:|..
plant    63 RGYMTNDDLEKAMKDFTKRCSKISRLYSIGKSVNGFPLWVIEISDRPGEIEAEPAFKYIGNVHGD 127

  Fly   881 EWISPATVTYIANQLVEGWEDLP---EHMRSINWYIHPVANPDGYEYSHTTDRLWRKNMRAHGRQ 942
            |.:....:..:||.:.:.::..|   ..:.:::.:|.|..||||:..        ||...|:   
plant   128 EPVGRELLLRLANWICDNYKKDPLAQMIVENVHLHIMPSLNPDGFSI--------RKRNNAN--- 181

  Fly   943 CPGVDLNRNFGYKWGGKGTSASPCSQTYRGSKAFSEPETFYISKFISGFPRE-TFQAYLSFHSYG 1006
              .|||||:|..::           ..:.......:|||    |.|..:.|: .|.|..:.|...
plant   182 --NVDLNRDFPDQF-----------FPFNDDLNLRQPET----KAIMTWLRDIRFTASATLHGGA 229

  Fly  1007 QYILYPWG-------YDYQLTQDRA--DLDRVARQA--GTSITKSTGVKYTVGSSATTLYPAAGG 1060
            ....:||.       |.|....|..  .|.|:..::  ..|::|......|.|:|   .||..||
plant   230 LVANFPWDGTEDKRKYYYACPDDETFRFLARIYSKSHRNMSLSKEFEEGITNGAS---WYPIYGG 291

  Fly  1061 SDDWAKGIAGIKYAYTIEMGD-----------------------------TGRYGFV-------- 1088
            ..|| ..|.|..:..|:|:.|                             ||.:|.:        
plant   292 MQDW-NYIYGGCFELTLEISDNKWPKASELSTIWDYNRKSMLNLVASLVKTGVHGRIFSLDKGKP 355

  Fly  1089 LP----ARFIQYNGKDGVTFADTVARAIAQGRGKSVARNSSGSRRR 1130
            ||    .:.|.|..|...|:|| ..|.:..|:...|..:|.|.:.:
plant   356 LPGLVVVKGINYTVKAHQTYAD-YHRLLVPGQKYEVTASSPGYKSK 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844 78/349 (22%)
SOL1NP_974126.1 M14_CP_plant 65..337 CDD:349482 66/303 (22%)
Peptidase_M14NE-CP-C_like 342..417 CDD:200604 15/60 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.