DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and AT5G42320

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_001332683.1 Gene:AT5G42320 / 834237 AraportID:AT5G42320 Length:430 Species:Arabidopsis thaliana


Alignment Length:291 Identity:75/291 - (25%)
Similarity:124/291 - (42%) Gaps:46/291 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   816 LTWQAYHRLEDIHGFIDYMAKTYPDICSTEII-----GYSVEKRPLKILKISNG-----NARNPG 870
            :.|..||..:|:...|..:...:||..|.|:|     ||:.|   :.::....|     :..|..
plant    40 INWDLYHSSDDLMEQIHSLVHRHPDKLSIELIKSGNKGYNAE---VNVVTYCRGGKESDDRSNFR 101

  Fly   871 IWIDGGMHAREWISPATVTYIANQLVEGWEDLPEH--------MRSINWYIHPVANPDGYEYSHT 927
            |.:..|.|.||.|:......|.:.|.|. :.||..        :..:...:.|:.||:|.:...:
plant   102 ILLTFGQHGRELITSELAFRILSILSEE-QFLPNKNGGILKNTLDKLVIKMVPIENPNGRKRVES 165

  Fly   928 TDRLWRKNMRAHGRQCPGVDLNRNFGYKWGGKGTSASPCSQTYRGSKAFSEPETFYISKFISGFP 992
            .|...|:|.|       |||||||:|..||.|.....| |:...|:..||||||..:.|....|.
plant   166 GDLCERRNGR-------GVDLNRNWGVDWGKKEKDYDP-SEENPGTAPFSEPETQIMRKLAISFD 222

  Fly   993 RETFQAYLSFHSYGQYILYPWGYDYQ-LTQDRADLDRVARQAGTSITKSTGV----KYTVGSSAT 1052
            .   ..:::.||..:.:..|  ||:: :|.:...    :::..|.:.|....    :..:||...
plant   223 P---HIWINVHSGMEALFMP--YDHKNITPEGLP----SQKMRTLLEKLNKFHCHDRCMIGSGGG 278

  Fly  1053 TL-YPAAGGSDDWAKGIAGIKYAYTIEM-GD 1081
            :: |.|.|.:.|:...:.....|:|.|: ||
plant   279 SVGYLAHGTATDYIYDVVKAPMAFTFEIYGD 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844 74/286 (26%)
AT5G42320NP_001332683.1 M14-CPA-like 100..321 CDD:349446 60/228 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524270at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.