DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and ENODL9

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_566665.1 Gene:ENODL9 / 821604 AraportID:AT3G20570 Length:203 Species:Arabidopsis thaliana


Alignment Length:149 Identity:32/149 - (21%)
Similarity:47/149 - (31%) Gaps:49/149 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SLLLVLGLNQVASMSLDRLALE--RNELPADQQQQQQQDVLVD-----------------NMKLT 70
            |||.|...||.:.:.:.|.|.:  ..:.|..:....:..|.::                 |.||.
plant    61 SLLFVYQSNQDSVLQVTRDAYDSCNTDSPTAKFADGKTSVTLNHSGPYYFISGNKDNCKKNEKLV 125

  Fly    71 SIPSADSSDMYMLVPDTVASQLEDTEHVNRNSIEADPESDPSGSSSSDMLMLESDSSPAMQLVEL 135
            .|..||.|.                   |:|:..:.|...|:.|..|      :.|.|.....|:
plant   126 VIVMADRSG-------------------NKNTASSPPSPAPAPSGES------APSPPVSGTFEM 165

  Fly   136 PSDITVAESQPETEHDTEN 154
            ....|     |.|..||.|
plant   166 TPAPT-----PTTSEDTPN 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844
ENODL9NP_566665.1 OsENODL1_like 28..129 CDD:259905 14/67 (21%)
rad23 118..>178 CDD:273167 20/89 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.