DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3108 and AGBL2

DIOPT Version :9

Sequence 1:NP_572262.1 Gene:CG3108 / 31506 FlyBaseID:FBgn0029807 Length:1132 Species:Drosophila melanogaster
Sequence 2:NP_079059.2 Gene:AGBL2 / 79841 HGNCID:26296 Length:902 Species:Homo sapiens


Alignment Length:175 Identity:38/175 - (21%)
Similarity:70/175 - (40%) Gaps:28/175 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 ADPESDPSGSSSSDMLMLESDSSPAMQLVELPSDITVAESQPETE-------HDTENDQQQPESI 162
            :|.||..|||.||     .||..| :.|..:..::|..:...:.:       ....|:|.|.:::
Human   711 SDIESSTSGSDSS-----LSDGLP-VHLANIADELTQKKKMFKKKKKKSLQTRKQRNEQYQKKNL 769

  Fly   163 EEHVVLMKPASQEAQLEQTVDLATEAAPVPL-NDE----LPEDEESPAATESAVEELEKESEAAM 222
            .:.:.|.:..|::|....|:    :..|... |.|    ||...|:|...|:.:...:|::  .:
Human   770 MQKLKLTEDTSEKAGFASTL----QKQPTFFKNSENSSFLPMKNENPRLNETNLNRRDKDT--PL 828

  Fly   223 DDQVPEESEIQPEQVQPGEYQSESDGEQAETKPEIEAQPEVEAQP 267
            |..:  .:.|.|:  ..|..|::..|......|:.......|..|
Human   829 DPSM--ATLILPK--NKGRMQNKKPGFTVSCSPKRTINSSQEPAP 869

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3108NP_572262.1 Propep_M14 730..797 CDD:280416
M14_CP_A-B_like 821..1112 CDD:199844
AGBL2NP_079059.2 GVQW 105..>120 CDD:290611
M14_AGBL2-3_like 407..666 CDD:133117
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 746..770 3/23 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 796..879 17/80 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.